PlGF-2/PLGF/PGF Protein, Mouse
SKU: 86071901833

PlGF-2/PLGF/PGF Protein, Mouse

Sale price$97.20 Regular price$108.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

PlGF-2/PLGF/PGF Protein, MouseProduct Specification Species Mouse Synonyms PGF, PLGF, PlGF2, PlGF, PGFL, SHGC 10760 Accession P49764 1 Amino Acid Sequence Val19 Pro158, with C terminal 8*His VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Mouse
Synonyms PGF, PLGF, PlGF2, PlGF, PGFL, SHGC-10760
Accession P49764-1
Amino Acid Sequence

Val19-Pro158, with C-terminal 8*His VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 25-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Review ProgRetin Eye Res.2019 Mar;69:116-136.Epub 2018 Oct 30.

Background

Placental growth factor (PGF), also known as vascular endothelial growth factor-related proteins PLGF and PlGF2, is a member of the vascular endothelial growth factor (VEGF) family. PlGF is a three-dimensional structure composed of 149 amino acids. PlGF is a dimeric glycoprotein formed by a 69kD α chain and a 34kD β chain connected by disulfide bond, with a unique cystine junction. These junctions are characterized by eight spatially conserved cysteines that are involved in intramolecular and intermolecular disulfide bond formation. PlGF is a pleiotropic factor affects different cell types and regulates various biological responses.PGF is not only activated during angiogenesis and endothelial cell growth, stimulating their proliferation and migration, but also promoting cell tumor growth.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86071901833

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1522 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stef
Massapequa, US
★★★★★ 5
Shark dog approved
Size: Large, Color: Broccoli, Size: Large, Color: Broccoli
My new baby shark.... I mean puppy really enjoys chewing. I can't just give her a ton of pig ears or bully sticks all day, which she would definitely love, so I'm constantly looking for well made chew toys. I'd put this right up with Kong. Very durable and nice. I also love the different textures, she seems to also love it. She can gnaw at the top and chew on the stem. She wanted it as soon as I opened it - it does smell like bacon but I haven't taken a chomp at it to be able to write a complete review! My dog is about 23 lbs but I can see a 80 lb dog chew this, it's not small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2025
N
Verified Purchase
Nunya B
Cuba, US
★★★★★ 4
So cute
Size: Large, Color: Pumpkin
My French Bulldogs have really strong jaws and are aggressive chewers. These really are sturdy and last a good amount of time. They are a bit heavy and awkward for my dogs to hold onto but they do like them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
B
Verified Purchase
Brandy REVIEWS
Dallas, US
★★★★★ 5
Cute toy and super tough!
Size: Small, Color: Lobster
My small dog is a serious chewer, and this lobster toy has been holding up great. Usually, he destroys toys within a day, but this one’s still going strong after a couple of weeks. The shape is perfect — easy for him to grab and chew, and the little claws keep him entertained. The filet mignon flavor must be good because he goes right for it every time. It’s sturdy without being too hard on his teeth, and it doesn’t leave any mess or pieces behind. If you’ve got a small but mighty chewer, this one’s definitely worth it. Cute design, lasts forever, and keeps my pup busy — total win. 🦞🐾
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2025
S
Verified Purchase
SS
Pawtucket, US
★★★★★ 5
Excellent toy
Size: X-Large, Color: Lobster
Very durable. Dog who has destroyed every toy ever purchased loves this and it is still in great condition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
H
Verified Purchase
Honorific Tails
Los Angeles, US
★★★★★ 3
Cheese the Day with Nylabone's Power Chew Cheese Chew Toy!
Size: X-Large, Color: Cheese
As a devoted dog parent, I've always believed that our furry friends deserve the best, especially when it comes to their favorite pastime—chewing! Nylabone's Power Chew Cheese Chew Toy is a game-changer that's added an extra layer of excitement to our dog's chewing routine. **Chew-Tastic Design:** First things first, the cheese-inspired shape of this chew toy is a hit in our household. Our dog can't resist its quirky design, and it's become a beloved addition to his chew toy collection. It's like a fun surprise every time he reaches for it! **Flavor Pockets for Fun:** What truly sets this chew toy apart is its flavor pockets. We fill them with spreadable treats, turning regular chew time into an epic adventure. Our dog absolutely loves the challenge of getting every last bit of treat, and it keeps him engaged for hours. **Dental Health Bonus:** Beyond the fun factor, the unique textures on this toy serve a dual purpose. Not only do they provide extra sensory enjoyment for our pup, but they also help clean his teeth as he chews. It's a win-win for both entertainment and dental health. **Built to Last:** Now, let's talk durability. Our dog is a power chewer, and this toy has proven to be up to the challenge. Made from Nylabone's most robust material, it's stood the test of time, promoting healthy chewing habits and saving our furniture from destruction. **Satisfaction All Around:** This chew toy isn't just for our dog's enjoyment; it brings joy to our family too. Seeing our furry friend so engaged and happy is priceless. It satisfies his natural urge to chew while teaching him healthy chewing habits. **A Flavorful Experience:** Did I mention the cheese flavor? It runs throughout the toy, adding another layer of enjoyment for our pup. It's like a delicious treat that never ends! **Perfect for Big Dogs:** As the proud parent of an extra-large dog, we opted for the "Souper" size, designed for dogs over 50 pounds. It's the perfect size for our gentle giant. In conclusion, Nylabone's Power Chew Cheese Chew Toy has become an integral part of our dog's life. It's more than just a chew toy; it's an adventure, a dental health solution, and hours of entertainment all rolled into one. We've embraced the mantra of "Cheese the Day" with this fantastic chew toy, and we wholeheartedly recommend it to fellow dog parents looking to add more joy and flair to their furry friend's life!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2023

recommand products