Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, Human
SKU: 76938227446

Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms IL 15RA, IL 15R alpha, Interleukin 15 Receptor Subunit Alpha, CD215 Accession Q13261 1 Amino Acid Sequence Ile31 Thr205, with C terminal human IgG1 Fc &Avi tag

Product Specification


Species Human
Synonyms IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215
Accession Q13261-1
Amino Acid Sequence

Ile31-Thr205, with C-terminal human IgG1 Fc &Avi tag ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

72-80kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, Mouse Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Clémentine Perrier , Ingrid Arijs, Dominiek Staelens, Christine Breynaert, Isabelle Cleynen, Kris Covens, Marc Ferrante, Gert Van Assche, Séverine Vermeire, Gert de Hertogh, Frans Schuit, Paul Rutgeerts, Jan L Ceuppens. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. mmunology. 138(1):47-56.

Background

IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76938227446

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1928 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Lexington, US
★★★★★ 5
Very Modern Handsome Suit
Color: Grey, Size: 7 Years, Color: Grey, Size: 7 Years
This is an incredibly sharp looking suit for the little guy. Great price and features, too. I made a mistake in sizing up instead of down and first one was too sloppy on him and would need alterations. He is thin and very thin in the waist. There is a lot of adjustment with buttons in waistband and coat hides the bunching. This shirt and coat will easily take a fuller body than slim I believe. He loves posing in it and feels very classy. Best purchase for a formal suit that will last longer than most kids clothes size wise. Felt bad about returning but careful folding and packing got it good as new.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
B
Verified Purchase
Berthav
Whiting, US
★★★★★ 5
Quality
Color: Black, Size: 7 Years, Color: Black, Size: 7 Years
Excellent quality, My son looks incredible
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
L
Lady Wescott
Bozeman, US
★★★★★ 4
Sharp Looking Kids Suit With One Missing Piece
Color: Navy, Size: 7 Years, Color: Navy, Size: 7 Years
I ordered this suit for my 6yo son in a size 7 so he would have a little room to grow and get more wear out of it, and sizing is perfect. He did not need it for any specific occasion, he just wanted a suit because apparently kindergarteners sometimes wake up and decide they are businessmen now. Let me start with the positives because there are a lot of them. This is a very well made suit. The jacket, pants, and dress shirt are all surprisingly nice quality. The fabric does not feel cheap or flimsy at all. The jacket has good structure, the buttons are well attached, the seams are clean, and all the little details like the collar and pockets look great. It honestly looks like a proper little formal suit. The pants are nicely made as well and pair perfectly with the jacket. The white dress shirt underneath is also good quality and completes the whole look. Overall, it is a really sharp outfit and would absolutely work for special occasions like weddings, recitals, formal events, church, or family photos. Now for the reason I am deducting one star. The listing specifically shows and mentions that this set includes a bow tie. That was actually the main reason I chose this particular suit over others. Some options only had a standard tie or no tie at all, but my son specifically wanted a bow tie. Unfortunately, the bow tie was not included with mine. That was definitely disappointing because it was one of the main selling points for me when choosing this set. Now I have to go find a separate bow tie that matches, which I was hoping to avoid. That said, I do want to be clear that this issue does not take away from the actual quality of the suit itself. The suit is genuinely very well made and looks fantastic on him. If your child needs a suit for a wedding, formal event, recital, or something similar, this would absolutely work. My son mostly just wanted a suit because he thinks it is cool, so now he has one and can show up to school looking like the smallest CEO in kindergarten. Overall, this is a very nice quality suit set. I just wish the bow tie that was advertised had actually been included.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
L
Verified Purchase
Liz
Belleville, US
★★★★★ 5
Good for the price
Color: Black, Size: 10 Years
Great suit for the price and it includes the shirt which It was a great surprise
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
V
Verified Purchase
Vicki Fontana
Cuba, US
★★★★★ 5
One size smaller is perfect!
Color: Navy, Size: 10 Years
This suit fit perfect but I did order one size smaller than my grandson normally wears. It is very well made and he can't wait to wear it in the wedding.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products