LDLR(D193A) His Tag Protein, Human
SKU: 33677528311

LDLR(D193A) His Tag Protein, Human

Sale price$380.70 Regular price$423.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LDLR(D193A) His Tag Protein, HumanProduct Specification Species Human Synonyms FH, FHC, LDL R, LDL Receptor, LDLCQ2 Accession P01130 Amino Acid Sequence Ala22 Arg788(Asp193Ala), with C terminal 8*His

Product Specification


Species Human
Synonyms FH, FHC, LDL R, LDL Receptor, LDLCQ2
Accession P01130
Amino Acid Sequence

Ala22-Arg788(Asp193Ala), with C-terminal 8*His AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGASSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 110-120kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Nature Cell Biology volume 25, pages937-949 (2023)Cite this article.

Background

Low density lipoprotein (LDL) receptor also known as LDLR, FH, FHC, LDLCQ2 is a Mosaic protein that belongs to the low density lipoprotein receptor gene family. LDL receptors are translated by ribosomes on the endoplasmic reticulum and are modified by the Golgi apparatus before travelling in vesicles to the cell surface. LDL Receptor consists of 840 amino acids (after removal of signal peptide) and mediates the endocytosis of cholesterol-rich LDL. It is a cell-surface receptor that recognizes the apoprotein B100 which is embedded in the phospholipid outer layer of LDL particles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33677528311

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 448 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jon Myers
Lowell, US
★★★★★ 5
Perfect charger
Size: 10FT, Color: White
Very impressed with how quickly the charger works. The longer cable has made it easier to use the phone while charging and sitting on the couch. No issues with the cable getting tangled or fraying like I have had with others, or pinching and breaking the connection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Life changing little screen
Size: 15.6" 1080P, Size: 15.6" 1080P
I was losing my mind trying to work from home off a single laptop screen. Secondary displays were not connecting to my computer outside of the office, IT could not figure out the issue so I was doomed to single screen anytime I worked from home. A co-worker suggested I take a look at this style of screen. I had my doubts that it would work with my lap top, and lo and behold I am back in action with a dual display. It comes with an HDMI cord option and a USB-C cord option (you do not need to buy separate cords, they are included). I used the USB-C as it also acts as a power cord to power the display. It took two seconds to hook up, and with one setting change on my lap top the display successfully extended (does not just duplicate your display, it will allow display extension as well). The image quality is more than sufficient for work (no opinion on PC gaming) and settings such as brightness were easy to adjust. It's the perfect size for use with my lap top screen, and they had plenty of additional size options. The built in stand allows two screen angles, and acts as a cover when not in use. For the price this thing is absolutely clutch, don't waste money on expensive displays - you can use this with any USB-C capable device so it can travel with you for work or fun. I will be interested to see if it has longevity, but for now I'd give this thing 10 stars if I could.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
T
Verified Purchase
Traveling Nurse
Draper, US
★★★★★ 5
Great product for a great price
Size: 15.6" 1080P
I REALLY like this. I need 2 screens to do my job efficiently and have struggled lately when traveling. Splurged on this for myself and was really impressed. It’s nice and lightweight but feels sturdy. The image quality is good. The set up could not be easier. This is a game changer for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
AH
Draper, US
★★★★★ 5
Works pretty well for a cheap monitor
Size: 15.6" 1080P
I work remote and travel, so I miss my multi monitor setup. Not anymore. I took this on a trip with me and it was great. The stand folded over to not take up too much desk space, the cables wear just long enough, another 6” would have been great but they worked. Quality of the screen is plenty good enough for office work, I have no gaming or artwork experience with it though. If you need an inexpensive 2nd monitor , this works great for on the go or even for a regular desk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
H
Verified Purchase
Hunter Blauvelt
Alexandria, US
★★★★★ 4
Great portable second screen
Size: 15.6" 1080P
Really convenient for a second screen on the go. The display looks sharp and it’s lightweight enough to carry around easily. Setup is simple, just plug and play. Not super bright, but works well for most uses.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026

recommand products